SMART: PDB domain 4kng

The domain within your query sequence starts at position 44 and ends at position 198; the E-value for the 4kng domain shown below is 6e-93.

QKAVIRVIPLKMDPTGKLNLTLEGVFAGVAEVTPAEGKLMQSHPLYLCNASDDDNLEPGF
ISIVKLESPRRAPRPCLSLASKARMAGERGANAVLFDITEDRSAAEQLQQPLGLTKPVVL
IWGSDAAKLMEFVYKNRKAYVWIELKEPPAGANYD

The domain within your query sequence starts at position 44 and ends at position 198; the E-value for the 4kng domain shown below is 6e-93.

This is a PDB domain - please see the PDBSUM entry of 4kng for further annotation